PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676718960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family ZF-HD
Protein Properties Length: 261aa    MW: 29515.9 Da    PI: 9.441
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676718960genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.99e-3274128358
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                  +v Y+eC++NhAas+Ggh+vDGCgEfm+s geegta++l CaAC+CHR+FHR+ev+
    676718960  74 SVSYRECQRNHAASTGGHVVDGCGEFMSS-GEEGTAESLLCAACDCHRSFHRKEVD 128
                  789*************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-3361137IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.5E-3075127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.76877126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.3E-2977127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.7E-28191259IPR009057Homeodomain-like
SuperFamilySSF466893.96E-18191258IPR009057Homeodomain-like
PROSITE profilePS500718.811195259IPR001356Homeobox domain
TIGRFAMsTIGR015658.3E-29197254IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MEERRKSPAN HQIVDHRLPP YTYSQTADKE KPTTKRNGSN PDPNPNPDLD TNLTSIAPAP  60
RSYVRPQTTS PTRSVSYREC QRNHAASTGG HVVDGCGEFM SSGEEGTAES LLCAACDCHR  120
SFHRKEVDGM FVVKFSSFGH SQRPLVSRHV SPIMMSFGGG GGGGGGRDPA ESSTEDLNKF  180
HQSFSGNGVD QFQYHPKKRF RTKFNQEQKE KMMEFAEKIS WRMSKPEDEE VNRFCREINV  240
KRQVFKVWMH NNKQAGKKKD M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-201982561876ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013695813.11e-165PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW71e-143ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A078JR931e-167A0A078JR93_BRANA; BnaCnng66730D protein
STRINGBra037224.1-P1e-160(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-138homeobox protein 24